DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and LPR2

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_565008.1 Gene:LPR2 / 843444 AraportID:AT1G71040 Length:581 Species:Arabidopsis thaliana


Alignment Length:604 Identity:123/604 - (20%)
Similarity:199/604 - (32%) Gaps:208/604 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 VLADGVERGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVT 291
            |.|.|..:...|    :|||:|:........:...||:. :...:.|..........:.|:|.|.
plant    90 VFAYGTSKRSAT----VPGPTIEAVYGVDTYVTWRNHLP-LHHILPWDPTISPAIPKHGGIPTVV 149

  Fly   292 QC------PIQQGNTFRY----------QWTGNAGTHF----------WHAH----TGLQKLDGL 326
            ..      |...||...:          :||... ||:          :|.|    |.:..|.||
plant   150 HLHGGIHEPTSDGNADSWFTAGFKETGSKWTKKT-THYVNKQQPGNMWYHDHAAGLTRVNLLAGL 213

  Fly   327 YGSVVVR----QPPSRDPNSHLYDFDLTTHIMLISDWLHEDAAERYPGRLAVN-TGQDP------ 380
            .||.::|    :.|.|.|....:|..|...          |.:.|..|.:.:| ||.:|      
plant   214 LGSYILRHSSVESPLRLPTGREFDRPLVIF----------DRSFRKDGSIYMNATGNNPTIHPQW 268

  Fly   381 ------ESMLINGKGQFRDPNTGFMTNTPLEIFTITPGRRYRFRMINA--------FASVCPAQV 431
                  :::::|||...|              .|:. .|:||||:.||        |.|      
plant   269 QPEYFGDAIIVNGKAWPR--------------LTVR-RRKYRFRITNASNARFFRFFFS------ 312

  Fly   432 TIEGHGMTVIATDGEPV-HPVDVNTIISFSGERYDFVISADQPVGAYWIQLRGLGECGIRRAQQL 495
              .|....|:.:|...: .||...:::....|..|.::...                  :...:.
plant   313 --NGLDFIVVGSDSAYLAKPVSTKSVLLAPSEIVDVLVDFS------------------KSTSKT 357

  Fly   496 AIL-RYARGPYQPASSPPTYDVGIPQGVILNPLDAICDRKRADAVCVSNLKNAKKVDKGVLVERP 559
            ||| ..|..|| |:..|.|                               :...||.|.::..:.
plant   358 AILANNAPYPY-PSGDPVT-------------------------------EENSKVMKFIINYKS 390

  Fly   560 DVKI-FLPFRFFVYEPKALFIPNTYNRFLVVPSGDHLTSLVDEISYISPPAPPLSQIDDIPPEYF 623
            :|.. .:|.:...| |.|....:|..|::.:            ..|:       |.||: |...:
plant   391 EVDTSIIPKKLIEY-PPAHVSTSTRTRYIAM------------FEYV-------SSIDE-PTHLY 434

  Fly   624 CNGDNRPPNCGPNCECTHMVDIPLGAIVEVVLVDEVQQVNLSHPFHLHGTAFYVV---GLGRSPD 685
            .||      ...|...|....|....:.||:.:.|.     :||.|:|...|.|:   .|.:|.:
plant   435 ING------LPYNAPVTETPKIGTSEVWEVINLTED-----NHPLHIHLGLFKVLEQTALVKSEE 488

  Fly   686 --KSIKKIN-------------LKHALELDQMG------MLERHFSKPPLKDTIAVPNNGYVVIR 729
              :.:.|.|             .|.|:.:.:.|      |:..|.:|..::.:....|..|   .
plant   489 FIECMTKRNDAVKCEISKYARGNKTAVTVHERGWKNVFKMMPGHVTKILVRFSYIHSNESY---S 550

  Fly   730 FRA-DNPGYWLFHCHFLFH 747
            |.| ..||| ::|||.|.|
plant   551 FDATQEPGY-VYHCHILDH 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 121/601 (20%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 27/132 (20%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951 31/170 (18%)
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972 41/174 (24%)
LPR2NP_565008.1 CuRO_1_BOD_CotA_like 69..220 CDD:259913 29/135 (21%)
SufI 82..580 CDD:225043 123/604 (20%)
CuRO_2_CotA_like 236..386 CDD:259936 42/232 (18%)
CuRO_3_CotA_like 413..577 CDD:259958 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.