DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and CG32554

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_728102.1 Gene:CG32554 / 32767 FlyBaseID:FBgn0052554 Length:239 Species:Drosophila melanogaster


Alignment Length:112 Identity:23/112 - (20%)
Similarity:40/112 - (35%) Gaps:34/112 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 VDIPLGAIVEVVLVDEVQQVNLSHPFHLHGTAFYVVGL-GRSPDKSIKKINLKHAL-ELDQMGML 705
            :|:|.|...:....|:|:.|:       :...:.:..| ...|....||.|::... |.||    
  Fly   105 LDVPNGVGKQKPPPDKVKLVS-------NADCYLIADLVVEGPAGPKKKPNIRRRTPEEDQ---- 158

  Fly   706 ERHFSKPPLKDTIAVPNNGYV-----------------VIRFRADNP 735
                |.|...|::.|..|..:                 |.::||.:|
  Fly   159 ----SAPEALDSVVVTGNSILEGRDLLAWAQKKTRHDKVFQYRASDP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 23/112 (21%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927
CuRO_2_tcLCC_insect_like 352..500 CDD:259951
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972 23/112 (21%)
CG32554NP_728102.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2132
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.