DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and F5

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_038946712.1 Gene:F5 / 304929 RGDID:1589758 Length:2226 Species:Rattus norvegicus


Alignment Length:419 Identity:85/419 - (20%)
Similarity:140/419 - (33%) Gaps:111/419 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 ERGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQC---- 293
            :.|||       ||.|:....|.:.|..:| |.....:|:.||:  ..|.|.|||...:..    
  Rat   453 QSGIL-------GPIIKAQVRDTLKIVFKN-MASRPYSIYPHGV--TFSPYEDGVNSSSTSGSHT 507

  Fly   294 ---PIQQGNTFRYQW--------TGNAG---THFWHAHTGLQK--LDGLYGSVVVRQPPSRDPNS 342
               |:|.|.||.|:|        |.|..   |..:::...:.:  ..||.|.:::.:..|.|...
  Rat   508 MIKPVQPGETFTYKWNILEFDEPTENDAQCLTRPYYSDVDVTRDIASGLIGLLLICKSRSLDQRG 572

  Fly   343 HLYDFDLTTHIMLI-----SDWLHEDAAERY---PGRL-----------AVNT--GQDPESMLIN 386
            .....|:...::..     ..|..||...::   |..:           .:||  |..|||:...
  Rat   573 IQRVADMEQEVVFAMFDENKSWYIEDNINKFCENPDEVKRDDPKFYESNIMNTINGYVPESISTL 637

  Fly   387 GKGQFRDPNTGFMTNTPLEIFTITPGRRYRFRMINAFASVCPAQVTIEGHGMTVIATDGEPVHPV 451
            |                   |......::.|..:.....:.....|  ||.. :.....|     
  Rat   638 G-------------------FCFDDAVQWHFCSVGTHDDILTVHFT--GHSF-IYGRRHE----- 675

  Fly   452 DVNTIISFSGERYDFVISADQPVGAYWIQLRGLGECGIRRAQQLAILRYARGPYQPASSPPTYDV 516
            |..|:...|||....|:   ..:|.:.:.......   ||.......|..:..........:|::
  Rat   676 DTLTLFPMSGESVTVVM---DNIGTWMLTTMSSNP---RRRNLRLRFRDVKCNRNDDDDEDSYEI 734

  Fly   517 GIPQGVILNPLDAICDRKRADAVCVSNLKNAKKVDKGVLVERPDVKIFLPFRFFVYEPKALFIPN 581
            ..|    |.| .::..||..|:|         :.|.|:..|..|         :.||..:.....
  Rat   735 YQP----LEP-TSMTTRKIHDSV---------ENDFGIENEDDD---------YQYELASTLGIR 776

  Fly   582 TYNRFLVVPSGD--HLTSLVDEIS--YIS 606
            ::.:.|:.|..|  :||:|..|.|  :||
  Rat   777 SFRKSLLNPKEDEFNLTALALENSSEFIS 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 85/419 (20%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 31/119 (26%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951 26/168 (15%)
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972 4/10 (40%)
F5XP_038946712.1 Cupredoxin <105..234 CDD:418529
Cupredoxin 246..364 CDD:418529
CuRO_3_FV_like 386..565 CDD:259992 31/121 (26%)
Cupredoxin 578..721 CDD:418529 28/175 (16%)
ARG80 <1090..1380 CDD:227400
Cupredoxin 1582..1757 CDD:418529
Cupredoxin 1769..1904 CDD:418529
FA58C 1911..2062 CDD:238014
FA58C 2070..2222 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11709
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.