DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and F8

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_032003.2 Gene:F8 / 14069 MGIID:88383 Length:2319 Species:Mus musculus


Alignment Length:600 Identity:105/600 - (17%)
Similarity:181/600 - (30%) Gaps:242/600 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 NRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYY-----------DGVPFVTQC 293
            ||.:||  :..|....|..    |:.||..|...|.|:..|..::           ..:.|:|  
Mouse   259 NRSLPG--LIGCHRKSVYW----HVIGMGTTPEIHSIFLEGHTFFVRNHRQASLEISPITFLT-- 315

  Fly   294 PIQQGNTFRYQWTGNAGTHFWHAHTGLQKLDGLYGSVVVRQPPS-------------RDPNSHLY 345
                ..|...    :.|......|....|.||:...|.|...|.             .|.:..||
Mouse   316 ----AQTLLI----DLGQFLLFCHISSHKHDGMEAYVKVDSCPEESQWQKKNNNEEMEDYDDDLY 372

  Fly   346 --------DFDLTTHIMLIS-------DWLHEDAAERYPGRLAVNTGQDPESMLINGKGQFRDPN 395
                    |:|.:..|.:.|       .|:|..:||......|       .|:..:..|.::   
Mouse   373 SEMDMFTLDYDSSPFIQIRSVAKKYPKTWIHYISAEEEDWDYA-------PSVPTSDNGSYK--- 427

  Fly   396 TGFMTNTPLEIFTITPGRRY---RF-------------------------------RMINAFASV 426
            :.:::|.|..|     ||:|   ||                               .::..|.:.
Mouse   428 SQYLSNGPHRI-----GRKYKKVRFIAYTDETFKTRETIQHESGLLGPLLYGEVGDTLLIIFKNQ 487

  Fly   427 CPAQVTIEGHGMTVIA-------------TDGEPVHPVDVNTIISFSGE--RYDFVISADQPVGA 476
            ......|..||:|.::             ....|:||          ||  :|.:.::.      
Mouse   488 ASRPYNIYPHGITDVSPLHARRLPRGIKHVKDLPIHP----------GEIFKYKWTVTV------ 536

  Fly   477 YWIQLRGLGECGIRRAQQLAILRYARGPYQPASSPPTYDVGIPQGVILNPLDAICDRKRADAVCV 541
                     |.|..::....:.||    |....:|   :..:..|:| .|| .||.::..|    
Mouse   537 ---------EDGPTKSDPRCLTRY----YSSFINP---ERDLASGLI-GPL-LICYKESVD---- 579

  Fly   542 SNLKNAKKVDKG--VLVERPDVKIFLPF----RFFVYEPKALFIPNTYNRFLVVPSGDHLTSLVD 600
                     .:|  ::.::.:|.:|..|    .:::.|....|:||...                
Mouse   580 ---------QRGNQMMSDKRNVILFSIFDENQSWYITENMQRFLPNAAK---------------- 619

  Fly   601 EISYISPPAPPLSQIDDIPPEYFCNGDNRPPNCGPNCECTHMVDIPLGAIVEVVLVDEVQQVNLS 665
                 :.|..|..|..:|                     .|.::   |.:.:          :|.
Mouse   620 -----TQPQDPGFQASNI---------------------MHSIN---GYVFD----------SLE 645

  Fly   666 HPFHLHGTAF-YVVGLGRSPDKSIKKINLKHALELDQMGMLERHFSKPPLKDTIAV-PNNGYVVI 728
            ....||..|: :::.:|...|          .|.:...|...:|  |...:||:.: |.:|..|.
Mouse   646 LTVCLHEVAYWHILSVGAQTD----------FLSIFFSGYTFKH--KMVYEDTLTLFPFSGETVF 698

  Fly   729 RFRADNPGYWLFHCH 743
             ...:|||.|:..||
Mouse   699 -MSMENPGLWVLGCH 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 104/599 (17%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 22/103 (21%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951 30/203 (15%)
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972 26/146 (18%)
F8NP_032003.2 Cupredoxin 22..202 CDD:302766
Cupredoxin 212..346 CDD:302766 22/102 (22%)
CuRO_3_FVIII_like 399..575 CDD:259889 38/224 (17%)
Cupredoxin 588..730 CDD:302766 33/192 (17%)
B 760..1640
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1530..1549
Cupredoxin 1684..1848 CDD:302766
Cupredoxin 1860..2003 CDD:302766
FA58C 2008..2156 CDD:214572
FA58C 2011..2155 CDD:238014
FA58C 2160..2313 CDD:214572
FA58C 2164..2312 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.