DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and LOC105947258

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_012817811.2 Gene:LOC105947258 / 105947258 -ID:- Length:408 Species:Xenopus tropicalis


Alignment Length:109 Identity:22/109 - (20%)
Similarity:35/109 - (32%) Gaps:30/109 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SATAELRRNPALSAPDECARACREGEPPRICYYHFTLEYYTVLGAACQVCTPNATNTVWSHCQCV 227
            |....::....|||.|     |:..|           :|....|..|..|       :.:.|...
 Frog   216 STAISMKSCDVLSASD-----CKANE-----------KYQISSGQCCGHC-------IQTSCMVT 257

  Fly   228 LADGVERGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTI 271
            .|.| :..:|...:::|.      .|||....|....:|...|:
 Frog   258 TASG-QVQLLQEGQIMPD------SNDKCTSYVCTVSQGQFSTV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 9/42 (21%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 9/42 (21%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972
LOC105947258XP_012817811.2 GHB_like 333..398 CDD:419725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257925at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.