DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and LOC105947063

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_031757176.1 Gene:LOC105947063 / 105947063 -ID:- Length:587 Species:Xenopus tropicalis


Alignment Length:106 Identity:29/106 - (27%)
Similarity:41/106 - (38%) Gaps:32/106 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 ECARACREGEPPRICYYHFTLEYYTVLGA-------ACQ--VCTPNATN----TVWSH---CQCV 227
            :||       |.::|.|. ..||.  ||:       :||  ||:.::||    .:..|   |...
 Frog   345 KCA-------PKKVCVYG-NAEYQ--LGSPVYSDPGSCQICVCSEDSTNNNVLNISCHPLPCSVH 399

  Fly   228 LADGVERGILTANRMIPGPSIQVCENDKVVIDVENHMEGME 268
            ..||.:.      |..||....|||....|:...|..|.:|
 Frog   400 CPDGYKL------RNDPGQCCGVCEQTHCVMKNGNSTELLE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 12/39 (31%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 12/39 (31%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972
LOC105947063XP_031757176.1 GHB_like 500..579 CDD:419725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257925at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.