DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stw and f8

DIOPT Version :9

Sequence 1:NP_001137606.1 Gene:stw / 35494 FlyBaseID:FBgn0286203 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_012825143.1 Gene:f8 / 100493411 XenbaseID:XB-GENE-1019544 Length:1489 Species:Xenopus tropicalis


Alignment Length:262 Identity:56/262 - (21%)
Similarity:100/262 - (38%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 GPSIQVCENDKVVIDVENHMEGMEVTIHWHGI----WQRGSQYYDGVPFVTQCPIQQ-------G 298
            ||:|:....|.:||..:| :..:..:||..|:    ...|.||.||.     .|::.       |
 Frog    84 GPTIRAETYDTLVIYFKN-LASIAYSIHGVGVSYGKSSEGVQYEDGT-----SPLENAGDAVPPG 142

  Fly   299 NTFRYQW--------TGN-----AGTHFWHAHTGLQKLDGLYGSVVVRQPPSRDPNSHLYDFDLT 350
            ..:.|.|        |.:     ...::.|::|......||.|::::.:|.|...:..  .|.:.
 Frog   143 EMYIYVWEIPLSYGPTASEPPCVTSAYYSHSNTSYDTNAGLVGAMLICKPGSLSADGS--QFGVQ 205

  Fly   351 THIMLISDWLHEDAAERYPGRLAVNTGQDPESMLINGKGQFRDPNTGFMTNTPLEIFTITPGRRY 415
            ..::|.:  :.:::...|    .:...::|.. .|||           .||:.|.:..|...:..
 Frog   206 ERVLLFA--IFDESKSHY----TMTKDEEPHH-TING-----------YTNSSLPVLVICRQKPL 252

  Fly   416 RFRMINAFASVCPAQVTIEGH-----GMTVIATDGEPVHPVDVNTIISFS---GERYDFVISADQ 472
            ...:|..........:::|||     |..||:.      ||...|.|:.|   |||..:.||...
 Frog   253 SLHVIGFGPHNEVHTISLEGHSFVVRGHRVISL------PVTAFTFITASIQPGERGKYNISCQN 311

  Fly   473 PV 474
            |:
 Frog   312 PL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stwNP_001137606.1 ascorbase 230..756 CDD:274555 56/262 (21%)
CuRO_1_tcLCC2_insect_like 230..333 CDD:259927 25/111 (23%)
CuRO_2_tcLCC_insect_like 352..500 CDD:259951 28/131 (21%)
CuRO_3_tcLLC2_insect_like 599..767 CDD:259972
f8XP_012825143.1 Cupredoxin 21..193 CDD:302766 25/114 (22%)
Cupredoxin 205..325 CDD:302766 28/133 (21%)
Cupredoxin 377..532 CDD:302766
Cupredoxin 545..683 CDD:302766
Cupredoxin 850..1007 CDD:302766
Cupredoxin 1021..1175 CDD:302766
FA58C 1180..1328 CDD:214572
FA58C 1183..1327 CDD:238014
FA58C 1332..1486 CDD:214572
FA58C 1336..1485 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.