DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and PTC1

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_010278.3 Gene:PTC1 / 851558 SGDID:S000002164 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:68/218 - (31%)
Similarity:109/218 - (50%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 EEETDEDQMANDNFCANMIEEPGK-----DSGCTAVVCLLQ-----------------GRDLYVA 409
            :|..|...:.||:|.|  |:|...     :|||||.||:|:                 .|.||.|
Yeast    84 DETRDVRDVLNDSFLA--IDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTA 146

  Fly   410 NAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNV 474
            |.||||.|:.|:|.:|.::.|||..|..|..|:.:|||.: :..||||.|.::|:|||..:    
Yeast   147 NVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLI-MKSRVNGMLAVTRSLGDKFF---- 206

  Fly   475 TLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELF 539
                 :.::...|....:.||.||:|::|||||:|:.:..::..|.::...:.|:....:.....
Yeast   207 -----DSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYAL 266

  Fly   540 DNCLAPNTMGDGTGCDNMTAVIV 562
            :|         || .||:|.::|
Yeast   267 EN---------GT-TDNVTVMVV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 66/211 (31%)
PTC1NP_010278.3 PP2Cc 12..279 CDD:214625 67/216 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.