DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT1G17545

DIOPT Version :10

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_173198.1 Gene:AT1G17545 / 838329 AraportID:AT1G17545 Length:179 Species:Arabidopsis thaliana


Alignment Length:103 Identity:25/103 - (24%)
Similarity:45/103 - (43%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 ENDNVKSPDTSSAESSDCTENDDDGDEDGNEDS---DEEETDEDQMANDNFCANMIEEPGKDSGC 394
            :::.:.||..:      |..:...|..||:..|   ....:.:|:|.........:       |.
plant    89 DHEGIISPTLT------CLTSHFFGIYDGHRRSRPVSGSVSSDDRMVLQAVSPETV-------GS 140

  Fly   395 TAVVCLLQGRDLYVANAGDSRCVISRSGQAIEMSIDHK 432
            ||||.|:....:.|:|.|.||.|:.|..:::.:|:|.|
plant   141 TAVVALVCSSHIIVSNCGGSRVVLLRGKESMPLSVDQK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 17/59 (29%)
AT1G17545NP_173198.1 PP2Cc 80..>179 CDD:469621 25/103 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.