DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and PLL2

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_195860.1 Gene:PLL2 / 830937 AraportID:AT5G02400 Length:674 Species:Arabidopsis thaliana


Alignment Length:528 Identity:103/528 - (19%)
Similarity:182/528 - (34%) Gaps:181/528 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SNLPLNEVL--EKYKGLPQKKDLDLKSSDHKENFKMRSPYFRGRRAAALAAEATNKAVMDPSAK- 201
            ::|||..|.  ..::..|...:..|.|:..:..| :..|...|..:..:  |:|.|...:...| 
plant   110 ASLPLQPVPRGSTWQSGPIVNESGLGSAPFERRF-LSGPIESGLYSGPI--ESTKKTEKEKPKKI 171

  Fly   202 -PDGSSTSAAAAAAALSADGVANSRNP---SNVVNPMAGADSN----------TTTSINDLSTKN 252
             ....|.........|.|:.::|:..|   .:|:.|:.|:||:          .|:|.::.:.|:
plant   172 RKKPKSKKNFLTFKTLFANLISNNNKPRLKKSVIEPINGSDSSDSGRLHHEPVITSSRSNENPKS 236

  Fly   253 AALKDDSVNDQN--------EGSNGTDFKHTLVSSSN---------------------------- 281
            ...::|.....|        :|..|.|..|.:||..|                            
plant   237 DLEEEDEKQSMNSVLDVQWAQGKAGEDRVHVVVSEDNGWVFVGIYDGFSGPDAPDYLLNNLYTAV 301

  Fly   282 -----------KKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINSSQDDEFTDDDA------ 329
                       :||.:.|.|.||:..:.|..|  :..:.||....||        :|||      
plant   302 QKELNGLLWNDEKLRSLGENGMTKTGKCSDEE--DPESGKENCPVIN--------NDDAVASGAR 356

  Fly   330 ----------DYEENDNVKSPDTSSAESSDCTENDDDGDEDGNEDSDEEETD------------- 371
                      ::|:..|.|            |::|:..|:.|:..:.....|             
plant   357 NQAKSLKWRCEWEKKSNNK------------TKSDNRCDQKGSNSTTTNHKDVLKALLQALRKTE 409

  Fly   372 ------EDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVISR-----SGQ-- 423
                  .|||..:|....::       |...:|.|::|.|:||.|.||||.|:.|     :|:  
plant   410 DAYLELADQMVKENPELALM-------GSCVLVTLMKGEDVYVMNVGDSRAVLGRKPNLATGRKR 467

  Fly   424 -----------------------------AIEMSIDHKPEDDEEASRIIKA---GGRVTLDGRVN 456
                                         .::::::|....:||..||.|.   ......:.||.
plant   468 QKELERIREDSSLEDKEILMNGAMRNTLVPLQLNMEHSTRIEEEVRRIKKEHPDDDCAVENDRVK 532

  Fly   457 GGLNLSRALGDHAYKT-----------NVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWN 510
            |.|.::||.|....|.           .:........|:..|.:....:|..|:|::|:.||::.
plant   533 GYLKVTRAFGAGFLKQPKWNDALLEMFRIDYIGTSPYITCSPSLCHHKLTSRDKFLILSSDGLYE 597

  Fly   511 YMSSEEVV 518
            |.|::|.:
plant   598 YFSNQEAI 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 43/195 (22%)
PLL2NP_195860.1 PP2Cc 259..665 CDD:238083 73/376 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.