DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and AT3G15260

DIOPT Version :10

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_188144.1 Gene:AT3G15260 / 820757 AraportID:AT3G15260 Length:289 Species:Arabidopsis thaliana


Alignment Length:195 Identity:65/195 - (33%)
Similarity:105/195 - (53%) Gaps:31/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 DNFCANMIEEPGKDSGCTAVVC-LLQGRDLYVANAGDSRCVISRSGQAIEMSIDHKP--EDDEEA 439
            |....:..::.|| .|.|||.. |:..:.|.|||.||||.||.::|.|..:|:||:|  |.||..
plant   119 DTTILDKADDLGK-GGSTAVTAILINCQKLVVANVGDSRAVICQNGVAKPLSVDHEPNMEKDEIE 182

  Fly   440 SRIIKAGGRVT-LDG---RVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEF 500
            :|    ||.|: ..|   ||:|.|.::||.||.:.|.:         :|:.|.:...||..:.||
plant   183 NR----GGFVSNFPGDVPRVDGQLAVARAFGDKSLKMH---------LSSEPYVTVEIIDDDAEF 234

  Fly   501 MVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFK 565
            ::||.||:|..||::|.|:.:: .:||.|   ...:.|.:..:|..:      .|:::.|:|:|:
plant   235 LILASDGLWKVMSNQEAVDSIK-GIKDAK---AAAKHLAEEAVARKS------SDDISVVVVKFQ 289

  Fly   566  565
            plant   290  289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 64/192 (33%)
AT3G15260NP_188144.1 PP2Cc 42..288 CDD:238083 64/192 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.