DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and DBP1

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:447 Identity:127/447 - (28%)
Similarity:184/447 - (41%) Gaps:137/447 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KAVMDP-------SAKPDG----SSTSAAAAAAALSADGVANSRNPSNVVNPMAGADSNTTTSIN 246
            :.:.||       ..||..    ||:|||||....:.|| ..|..|.|                 
plant     5 RGISDPENGSSSYGGKPPNPLSFSSSSAAAAVYRQTFDG-ERSLAPCN----------------- 51

  Fly   247 DLSTKNAALKDDSVNDQNEGSNGTDFKHTLVSSSNKKLFATGSNDMTELNQSSKNEFTNSSTSKE 311
                                      |.:||..|:  |..|..:|:     |.:||||......|
plant    52 --------------------------KRSLVRHSS--LVKTMVSDI-----SVENEFTIEKNKSE 83

  Fly   312 FERNINSSQDDEFTD-------DDADYEENDNVKSPDTSSAESSDCTENDDDGDEDGN------- 362
            |   :.:::...::|       :|| |...||..  |:....:|:...:...|..||:       
plant    84 F---VPATRSGAWSDIGSRSSMEDA-YLCVDNFM--DSFGLLNSEAGPSAFYGVFDGHGGKHAAE 142

  Fly   363 -----------EDSDEEETDEDQMANDNFCAN---MIEEPGKD----SGCTAVVCLLQGRDLYVA 409
                       || .|..::.:::.:..|...   .:|....|    ||.||:..:|.||.|.||
plant   143 FACHHIPRYIVED-QEFPSEINKVLSSAFLQTDTAFLEACSLDGSLASGTTALAAILFGRSLVVA 206

  Fly   410 NAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGD-HAYKTN 473
            ||||.|.|:||.|:|||||.||||...:|..||..:||.| .||.:||.||::||||| |.    
plant   207 NAGDCRAVLSRQGKAIEMSRDHKPMSSKERRRIEASGGHV-FDGYLNGQLNVARALGDFHM---- 266

  Fly   474 VTLPAEEQM-----------ISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKD 527
                  |.|           :.|.|::....:|.||||:::.|||:|:...|:..|:|.|.||::
plant   267 ------EGMKKKKDGSDCGPLIAEPELMTTKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQE 325

  Fly   528 NKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQELQSTIPPNQTEDKL 584
            :.......:||.:..|...:      .||:|||:|.       ||...|||....:|
plant   326 HNDPVMCSKELVEEALKRKS------ADNVTAVVVC-------LQPQPPPNLVAPRL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 77/208 (37%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 127/447 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.