DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and PIA1

DIOPT Version :10

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_973490.1 Gene:PIA1 / 816590 AraportID:AT2G20630 Length:290 Species:Arabidopsis thaliana


Alignment Length:184 Identity:60/184 - (32%)
Similarity:103/184 - (55%) Gaps:27/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 GKDSGCTAVV-CLLQGRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVT-L 451
            || .|.|||. .|:.|:.|.:||.||||.|:|::|.|.::|:||:|  .:|...|...||.|: :
plant   120 GK-GGSTAVTGILIDGKTLVIANVGDSRAVMSKNGVASQLSVDHEP--SKEQKEIESRGGFVSNI 181

  Fly   452 DG---RVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMS 513
            .|   ||:|.|.::||.||.:.|.:         :|:.|||:...|..|.||::.|.||:|..||
plant   182 PGDVPRVDGQLAVARAFGDKSLKIH---------LSSDPDIRDENIDHETEFILFASDGVWKVMS 237

  Fly   514 SEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKK 567
            ::|.|:.:: .:||.:   ...:||.:..::..:      .|:::.::..|.::
plant   238 NQEAVDLIK-SIKDPQ---AAAKELIEEAVSKQS------TDDISCIVPCFLRR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 59/179 (33%)
PIA1NP_973490.1 PP2Cc 43..278 CDD:238083 59/179 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.