DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ILKAP

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:443 Identity:112/443 - (25%)
Similarity:174/443 - (39%) Gaps:118/443 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 RSPYFRGRRAAALAAEATNKAVMDPSAKPDGSSTSAAAAAAALSADGVANSRNPSNVVNPMAGAD 238
            |||    |.||...|:   |..:.....|..|||.:.:....|..|           :.|.:..|
Human    12 RSP----RPAAGKEAQ---KGPLLFDDLPPASSTDSGSGGPLLFDD-----------LPPASSGD 58

  Fly   239 SNT-TTSINDL-STKNAALKDDSVNDQNEGSNGTDFKHTLVSSSNKKLFATGS------------ 289
            |.: .|||:.: .|:....|..:..::..||.  :.....|..::..:|....            
Human    59 SGSLATSISQMVKTEGKGAKRKTSEEEKNGSE--ELVEKKVCKASSVIFGLKGYVAERKGEREEM 121

  Fly   290 -------NDMTELNQSSKNEFTNSS------------TSKEFERNINSSQDDEFTDDDADYEEND 335
                   ||:||..:...:..|..|            .||...:|::.:...:|...|....|. 
Human   122 QDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEK- 185

  Fly   336 NVKS--PDTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMIEEPGKDSGCTAVV 398
            .||.  .||.                        :.|||:.:...:     .::|....|.||..
Human   186 TVKRCLLDTF------------------------KHTDEEFLKQAS-----SQKPAWKDGSTATC 221

  Fly   399 CLLQGRDLYVANAGDSRCVISRSGQ------AIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNG 457
            .|.....||:||.||||.::.|..:      |:.:|.:|.|...||..||.||||.|. ||||.|
Human   222 VLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVR-DGRVLG 285

  Fly   458 GLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVR 522
            .|.:||::||..||        ...::::|||::..:||.|.|::|||||::...:.||.|.|:.
Human   286 VLEVSRSIGDGQYK--------RCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFIL 342

  Fly   523 CRLKDNK------------KLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQ 563
            ..|:|.|            :....|     |.||...:..|: .||:|.::|:
Human   343 SCLEDEKIQTREGKSAADARYEAAC-----NRLANKAVQRGS-ADNVTVMVVR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 67/208 (32%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 23/95 (24%)
PP2Cc 108..390 CDD:238083 86/327 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.