DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ilkap

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_075832.1 Gene:Ilkap / 67444 MGIID:1914694 Length:392 Species:Mus musculus


Alignment Length:438 Identity:107/438 - (24%)
Similarity:171/438 - (39%) Gaps:113/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 RGRRAAALAAEATNKAVMDPSAKPDGSSTSAAAAAAALSADGVANSRNPSNVVNPMAGADSNT-- 241
            |..|.:| ..||..:.|:.... |..|||.:.:....|..|           :.|.|..:|.:  
Mouse    12 RAPRPSA-GKEAQGRPVLFEDL-PPASSTDSGSGGPLLFDD-----------LPPAASGNSGSLA 63

  Fly   242 TTSINDLSTKNAALKDDSVNDQNEGSNGTDFKHTLVSSSNKKLFATGS----------------- 289
            |:....:.|:....|..:..::..|  |.:.....|..::..:|....                 
Mouse    64 TSGSQVVKTEGKGAKRKAPEEEKNG--GEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHV 126

  Fly   290 --NDMTELNQSSKNEFTNSS------------TSKEFERNINSSQDDEFTDDDADYEENDNVKS- 339
              ||:|:......:..|..|            .||...:|::.:...:|...|....|. .||. 
Mouse   127 ILNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEK-TVKRC 190

  Fly   340 -PDTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQG 403
             .||.                        :.|||:.:...:     .::|....|.||...|...
Mouse   191 LLDTF------------------------KHTDEEFLKQAS-----SQKPAWKDGSTATCVLAVD 226

  Fly   404 RDLYVANAGDSRCVISRSGQ------AIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLS 462
            ..||:||.||||.::.|..:      |:.:|.:|.|...||..||.||||.|. ||||.|.|.:|
Mouse   227 NILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVR-DGRVLGVLEVS 290

  Fly   463 RALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKD 527
            |::||..||        ...::::|||::..:||.|.|::|||||::...:.||.|.|:...|:|
Mouse   291 RSIGDGQYK--------RCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLED 347

  Fly   528 NK------------KLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQ 563
            :|            :....|     |.||...:..|: .||:|.::|:
Mouse   348 DKIQTREGKPAVDARYEAAC-----NRLANKAVQRGS-ADNVTVMVVR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 67/208 (32%)
IlkapNP_075832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 20/93 (22%)
PP2Cc 108..390 CDD:238083 85/327 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.