DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ilkap

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:214 Identity:70/214 - (32%)
Similarity:107/214 - (50%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 EETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVISRSGQ------AIE 426
            :.|||:.:...:     .::|....|.||...|.....||:||.||||.::.|..:      |:.
  Rat   196 KHTDEEFLKQAS-----SQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALS 255

  Fly   427 MSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKK 491
            :|.:|.|...||..||.||||.|. ||||.|.|.:||::||..||        ...::::|||::
  Rat   256 LSKEHNPTQYEERMRIQKAGGNVR-DGRVLGVLEVSRSIGDGQYK--------RCGVTSVPDIRR 311

  Fly   492 LIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNK------------KLSTICEELFDNCLA 544
            ..:||.|.|::|||||::...:.||.|.|:...|:|.|            :....|     |.||
  Rat   312 CQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKPAVDARYEAAC-----NRLA 371

  Fly   545 PNTMGDGTGCDNMTAVIVQ 563
            ...:..|: .||:|.::|:
  Rat   372 NKAVQRGS-ADNVTVMVVR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 67/208 (32%)
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
PP2Cc 108..390 CDD:238083 70/214 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.