DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and PDP2

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001316857.1 Gene:PDP2 / 57546 HGNCID:30263 Length:529 Species:Homo sapiens


Alignment Length:163 Identity:43/163 - (26%)
Similarity:73/163 - (44%) Gaps:33/163 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SGCTAVVCLLQGRDLYVANAGDSRCVI-----SRSGQAIEMSIDHKPEDDEEASRIIK-----AG 446
            ||.||.:..:.|..|:||||||.|.::     :.....:.::.||...:..|.||:.:     ..
Human   265 SGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESED 329

  Fly   447 GRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAE-----------------------EQMISALPD 488
            ..:.::.|:.|.|...||.||...|.:..|...                       ...::|.|:
Human   330 RTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPE 394

  Fly   489 IKKLIITPEDEFMVLACDGIWNYMSSEEVVEFV 521
            :....:.|:|:|:|||.||:|:.:|:|:||..|
Human   395 VTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 43/163 (26%)
PDP2NP_001316857.1 PP2Cc 109..517 CDD:238083 43/163 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.