DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ppm1nb

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001096587.1 Gene:ppm1nb / 564875 ZFINID:ZDB-GENE-071004-34 Length:435 Species:Danio rerio


Alignment Length:267 Identity:90/267 - (33%)
Similarity:131/267 - (49%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 SAESSDCTENDDD---GDEDGNEDSDEEETDED-----QMANDNFCANMIEEPGKDSGCTAVVCL 400
            ||.:.:|:.|..|   |......|.|.|...|.     .:.:.:..|....|..:..|.|.|...
Zfish   120 SAVAQNCSRNLLDHILGTGKIRADEDVERVTEGFKEGFFLMDKHLHAMACREGWERGGTTVVSTA 184

  Fly   401 LQGRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRAL 465
            :....:|..|.||||.|:.|:|:....:.||||....|..||..|||.|||. ||||.|.:||||
Zfish   185 ITPHHIYFVNCGDSRAVLCRAGRVAFSTEDHKPFSPGEKERIESAGGSVTLQ-RVNGSLAVSRAL 248

  Fly   466 GDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKK 530
            ||.:|||.......|||:|..|::..:..:|.|||:||||||:|:.:|:||:..||..||:....
Zfish   249 GDFSYKTVEWRSVTEQMVSPEPEVSVVERSPADEFLVLACDGVWDTVSNEELCAFVHSRLRICTD 313

  Fly   531 LSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQ----------ELQSTIPPNQTEDKLL 585
            |..:|.::.|.||...::      ||::.::|.|....|          ||:..:     |.|:.
Zfish   314 LREVCSQVIDLCLYKGSL------DNISIILVCFPGAPQLSPEALHHEAELEDFL-----ESKVA 367

  Fly   586 KTSENVS 592
            :..|.:|
Zfish   368 EIFEELS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 72/189 (38%)
ppm1nbNP_001096587.1 PP2Cc 79..341 CDD:238083 82/227 (36%)
PP2C_C 335..412 CDD:285117 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.