DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and pptc7b

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:210 Identity:36/210 - (17%)
Similarity:74/210 - (35%) Gaps:83/210 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 TAVVCLLQGRD--LYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNG 457
            ||.:.:|..|.  ::..|.|||..::.|.|:.:..|       ||:                   
Zfish   131 TACIVVLDRRSHRIHTCNLGDSGFLVVRGGEVVHRS-------DEQ------------------- 169

  Fly   458 GLNLSRALGDHAYKT----NVTLPAEEQMISALPDIKKLIITPE-----------DEFMVLACDG 507
                     .|.:.|    ::..|..|.::  |.|      :||           .:.::.|.||
Zfish   170 ---------QHYFNTPFQLSIAPPGAEGVV--LSD------SPEAADSSSFDVQLGDIILTATDG 217

  Fly   508 IWNYMSSEEVVEFVRCRLKD------NKKLSTICEELFDNCLAPNTMGDGT--GCDN-------- 556
            :::.|....:::.:: :||:      .:...:|.|:..:....||.|....  .|||        
Zfish   218 LFDNMPDYMILQELK-KLKNTNYDSIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGK 281

  Fly   557 ------MTAVIVQFK 565
                  :.:::.::|
Zfish   282 PDDITVLLSIVAEYK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 35/207 (17%)
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 35/201 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.