DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ppm1la

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001071068.1 Gene:ppm1la / 556994 ZFINID:ZDB-GENE-061103-118 Length:361 Species:Danio rerio


Alignment Length:339 Identity:100/339 - (29%)
Similarity:153/339 - (45%) Gaps:71/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TDFKHTLVSSS----------------NKKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINS 318
            ||...|:|.||                |.:|   |..|:.:...|...||.|::.:....:....
Zfish    42 TDEVKTIVKSSRDAVKMVKGKVAEMMMNDRL---GGLDVLDAEFSKTWEFKNNNVAVYSIQGRRD 103

  Fly   319 SQDDEF---TD--------DDADYEENDNVKSPDTSSAESSDCTENDDDGDEDGNEDSD------ 366
            ..:|.|   ||        ..|.::.:....:.|...|...:..:......|...:||.      
Zfish   104 HMEDRFEVLTDLANRSHPSIFAIFDGHGGEGAADYVKAHLPEALKQQLQAFEREKKDSPLSYPSI 168

  Fly   367 -EEE---TDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVI-SRSGQAIE 426
             |:.   .|.|.:  :.|.|:..|     :|.|.::.||..|:|.|||.||||.|: .:.|.|:.
Zfish   169 LEQRILAVDRDMV--EKFSASHDE-----AGTTCLIALLSDRELTVANVGDSRGVLCDKDGNAVA 226

  Fly   427 MSIDHKPEDDEEASRIIKAGGRVTLDG--RVNGGLNLSRALGDHAYKT-NVTLPAEEQMISALPD 488
            :|.||||...:|..||.:|||.::.:|  ||.|.|.:||:|||:..|. ||.:|..:.:..   |
Zfish   227 LSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTF---D 288

  Fly   489 IKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNK--KLSTICEELFDNCLAPNTMGDG 551
            :.||    :.|||:||.||:|:..|:||.|.|||.||.:..  ..|.:.:..:..|  |      
Zfish   289 LDKL----QPEFMILASDGLWDAFSNEEAVRFVRERLDEPHFGAKSIVLQSFYRGC--P------ 341

  Fly   552 TGCDNMTAVIVQFK 565
               ||:|.::|:||
Zfish   342 ---DNITVMVVKFK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 71/195 (36%)
ppm1laNP_001071068.1 PP2Cc 93..351 CDD:238083 84/282 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.