DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ppm1j

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_684981.2 Gene:ppm1j / 556950 ZFINID:ZDB-GENE-091230-9 Length:496 Species:Danio rerio


Alignment Length:281 Identity:65/281 - (23%)
Similarity:110/281 - (39%) Gaps:95/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 DDADYEENDNVK---------SPDTSSAESSDCTENDDDGDED--GNEDSDEEETDEDQMANDNF 380
            |.|...||.|..         ||..:..:...|.    ||:|.  |..|......::| ::.::.
Zfish   163 DVAHLLENHNSPPPICLAKNGSPFQAEGKKGACL----DGEEQDAGLPDEPRFHMEKD-ISVESL 222

  Fly   381 CANMIE----------EPGKDS-----GCTAVVCL-LQGRDLYVANAGDSRCVISRSGQAIEMSI 429
            ...:||          |..|:|     ||.|:|.: |.|: ||||||||||.:|.|:.:.|.||.
Zfish   223 VMGIIETAFRQMDDLIEKEKESYSISGGCCALVAIHLMGK-LYVANAGDSRAIIVRNSEVIPMST 286

  Fly   430 DHKPEDDEEASRII------------------------KAGGRV-----TLDG------------ 453
            :..||.:.:..:.:                        :.|.::     |:.|            
Zfish   287 EFTPESERQRLQYLGFLKPELLGNEFTHIEFPRRIQHKELGKKMLFRDHTMTGWAYKTIIEDDLK 351

  Fly   454 -----------RVNGGLNLSRALGDH---AYKTNVTLPAEEQMISALPDIKKLIITP----EDEF 500
                       ||...:.::|.||||   .|.:|:.:   :..:|..|::|...|:.    .|:.
Zfish   352 FPLIYGEGKKARVMATIGVTRGLGDHDLKVYNSNIYI---KPFLSCCPEVKVYNISEHKHGSDDV 413

  Fly   501 MVLACDGIWNYMSSEEVVEFV 521
            :|:..||:|:..:..:|.:.|
Zfish   414 LVMGSDGLWDVTADRDVADAV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 51/223 (23%)
ppm1jXP_684981.2 PP2Cc 130..489 CDD:238083 65/281 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.