DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and CG6036

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster


Alignment Length:565 Identity:111/565 - (19%)
Similarity:166/565 - (29%) Gaps:291/565 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYLSHPKTDKTSTDQFNELLAVGASSMQGWRNSQEDAHNSILNFDN---NTSFFAVYDGHGGA 62
            ||.:|..|:|:|.:.:.....|....|||||||...||:|::.....:   ..|:|||:|||.|:
  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRLKDPFATWSYFAVFDGHAGS 69

  Fly    63 EVAQYCADKLPHFLKNLETYKNGQFEVALKEAFLGFDKTLLDPSIVSILKILAGEHNFVDAEADD 127
            :::.:||:.|...:...|::...::|..::|.||..|                            
  Fly    70 QISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLD---------------------------- 106

  Fly   128 YEEEDLAELQEESNLPLNEVLEKYKGLPQKKDLDLKSSDHKENFKMRSPYFRGRRAAALAAEATN 192
               ||:.:|                                                        
  Fly   107 ---EDMRKL-------------------------------------------------------- 112

  Fly   193 KAVMDPSAKPDGSSTSAAAAAAALSADGVANSRNPSNVVNPMAGADSNTTTSINDLSTKNAALKD 257
                                                                             
  Fly   113 ----------------------------------------------------------------- 112

  Fly   258 DSVNDQNEGSNGTDFKHTLVSSSNKKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINSSQDD 322
              .:||..||                                                       
  Fly   113 --YHDQQGGS------------------------------------------------------- 120

  Fly   323 EFTDDDADYEENDNVKSPDTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMIEE 387
                                                                             
  Fly   121 ----------------------------------------------------------------- 120

  Fly   388 PGKDSGCTAVVCLLQGRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLD 452
                   ||:...:....:|:.|.||||.||||:|.|:..:|||||...:|..||..|||.|.:.
  Fly   121 -------TAICVFVSPDKIYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIK 178

  Fly   453 GRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEV 517
             |:||.|.:|||.||:.:|.:.:....:||:|..|||.....:..|||:|:||||||:.|:|.||
  Fly   179 -RINGTLAVSRAFGDYDFKNDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEV 242

  Fly   518 VEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIV 562
            .||:|.||.....|..|...:.|.||...:.      ||||.:::
  Fly   243 CEFIRSRLLVTYDLPMIVNSVLDICLHKGSR------DNMTLLLL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625 27/84 (32%)
PP2Cc <374..564 CDD:238083 70/189 (37%)
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 102/537 (19%)
PP2C_C 284..352 CDD:285117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.