DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and CG12091

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:213 Identity:39/213 - (18%)
Similarity:82/213 - (38%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 NFCANMIEEPGKDSGCTAVVCLLQGRD---LYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEAS 440
            ::| .::|:.....|.:....|:..|:   ::.||.|||..|:.|.||.:     ||.|:.:   
  Fly   141 SYC-ELMEQKKPILGSSTACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HKSEEQQ--- 196

  Fly   441 RIIKAGGRVTLDGRVNGGLNLSRALGDHAYKT--NVTLPAE---EQMISALPDIKKLIITP--ED 498
                                       |.:.|  .::||..   ..::|..|:....:..|  :.
  Fly   197 ---------------------------HYFNTPFQLSLPPPGHGPNVLSDSPESADTMSFPVRDG 234

  Fly   499 EFMVLACDGIWNYMSSEEVVEF----------VRCRLKDNKKLSTICEELFDNC--LAP------ 545
            :.:::|.||:::.:..:.:::.          |:.::..| .|:.:...|..|.  |:|      
  Fly   235 DVILIATDGVFDNVPEDLMLQVLSEVEGERDPVKLQMTAN-SLALMARTLSLNSEFLSPFALSAR 298

  Fly   546 --NTMGDGTGCDNMTAVI 561
              |....|...|::|.|:
  Fly   299 RNNIQARGGKPDDITVVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 39/213 (18%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 38/211 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.