DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and CG15035

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_572396.1 Gene:CG15035 / 31673 FlyBaseID:FBgn0029949 Length:374 Species:Drosophila melanogaster


Alignment Length:296 Identity:53/296 - (17%)
Similarity:94/296 - (31%) Gaps:108/296 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 ELNQSSKNEFTNSSTSKEFERNINSSQDDEFT-------DDDADY--EEN--------------- 334
            ||.|:|:| ..|.|.|:...:.::.....::|       |.:.||  ::|               
  Fly    52 ELAQNSEN-IGNGSMSENQNQRLDPMTSAQYTTLGFGNFDGEGDYLRQKNKINIQLPRLVSVTCG 115

  Fly   335 ---DNVKSPDTS-----------SAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMI 385
               |:::.|:.:           |:....|.....||  .|...:...:..:..|.....|..|.
  Fly   116 FAKDHIRYPEYNRGKFGEDAWFMSSSPQACIMGVADG--VGGWRNYGVDPGKFSMTLMRSCERMS 178

  Fly   386 EEPGKD-----------------------SGCTAVVCLLQGRD--LYVANAGDSRCVISRSGQAI 425
            ..|...                       ..|||.:..|:..|  ||.||.|||..::.|||:.:
  Fly   179 HAPDFKPNRPEILLERAYFDLLDQKCPIVGSCTACILALKRDDSTLYAANIGDSGFLVVRSGKVV 243

  Fly   426 EMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPA-----EEQMISA 485
            ..|.:.:                                   |.:.|...|.:     :...:|.
  Fly   244 CRSQEQQ-----------------------------------HQFNTPYQLASPPPGYDFDAVSD 273

  Fly   486 LPDIKKLIITPED--EFMVLACDGIWNYMSSEEVVE 519
            .|:....|..|..  :.::||.||:::.:....:||
  Fly   274 GPESADTIQFPMQLGDVILLATDGVYDNVPESFLVE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 33/178 (19%)
CG15035NP_572396.1 PP2Cc 133..371 CDD:294085 38/214 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.