DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ppm1l

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001101151.1 Gene:Ppm1l / 310506 RGDID:1305220 Length:360 Species:Rattus norvegicus


Alignment Length:349 Identity:97/349 - (27%)
Similarity:155/349 - (44%) Gaps:79/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TDFKHTLVSSS----------------NKKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINS 318
            ||...|:|.||                |.:|   |..|:.|...|...||.:.:.:....:....
  Rat    42 TDEVKTIVKSSRDAVKMVKGKVAEIMQNDRL---GGLDVLEAEFSKTWEFKSHNVAVYSIQGRRD 103

  Fly   319 SQDDEF---TD-------------------DDADYEENDNVKS--PDTSSAESSDCTENDDDGDE 359
            ..:|.|   ||                   ..|:|     |||  |:.......|.     :.|:
  Rat   104 HMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEY-----VKSRLPEALKQHLQDY-----EKDK 158

  Fly   360 DGNEDSDEEETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVI-SRSGQ 423
            :.:..:.:...::..::.|......:.....::|.|.::.||..:||.|||.||||.|: .:.|.
  Rat   159 ENSVLTYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGN 223

  Fly   424 AIEMSIDHKPEDDEEASRIIKAGGRVTLDG--RVNGGLNLSRALGDHAYKT-NVTLPAEEQMISA 485
            ||.:|.||||...:|..||.:|||.::.:|  ||.|.|.:||:|||:..|. ||.:|..:.:.. 
  Rat   224 AIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTF- 287

  Fly   486 LPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNK--KLSTICEELFDNCLAPNTM 548
              |:.||    :.|||:||.||:|:..|:||.|.|::.||.:..  ..|.:.:..:..|  |   
  Rat   288 --DLDKL----QPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGC--P--- 341

  Fly   549 GDGTGCDNMTAVIVQFK--KKLQE 570
                  ||:|.::|:|:  .|.:|
  Rat   342 ------DNITVMVVKFRNSSKTEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 68/195 (35%)
Ppm1lNP_001101151.1 PP2Cc 93..351 CDD:238083 80/285 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.