DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ppm1f

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_786931.1 Gene:Ppm1f / 287931 RGDID:631363 Length:450 Species:Rattus norvegicus


Alignment Length:433 Identity:99/433 - (22%)
Similarity:159/433 - (36%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FRGRRAA--ALAAEATNKAVMD------------PSAKPDGSSTSAAAAAAALSADGVANS---- 224
            |.|.|.|  |:||..|::|:..            |..:.:............|.|.|::.|    
  Rat    64 FLGSRNAPPAVAAAVTHEAISQLLQTDLSEFKRLPEQEEEEEEEEERVLTTLLDAKGLSRSFFNC 128

  Fly   225 ----------RNPSNVVNPMAGADSNTTTSINDLSTKNAALKDDSVNDQNEGSNGTDFKHT--LV 277
                      |.|.....|    ......||:.:......::|..|       :...|.|.  |.
  Rat   129 LWEVCSQWQKRVPLTAQAP----QRKWLVSIHAIRNTRRKMEDRHV-------SLPAFNHLFGLS 182

  Fly   278 SSSNKKLFAT--GSNDMTELNQSSKNEFTNSSTSKEFERNINSSQDDEFTDDDADYEENDNVKSP 340
            .|.::..||.  |...:.....:|.:..||:           |.|.:..||             |
  Rat   183 DSVHRAYFAVFDGHGGVDAARYASVHVHTNA-----------SHQPELLTD-------------P 223

  Fly   341 DTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMIEEPGKD---SGCTAVVCLLQ 402
            ..:..|:...|                     |||        .:::..::   ||.|.|..|:.
  Rat   224 AAALKEAFRHT---------------------DQM--------FLQKAKRERLQSGTTGVCALIT 259

  Fly   403 GRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDG--RVNGGLNLSRAL 465
            |..|:||..|||:.::.:.||.:::...||||..:|.|||...||.|:|..  ||||.|.:|||:
  Rat   260 GAALHVAWLGDSQVILVQQGQVVKLMEPHKPERQDEKSRIEALGGFVSLMDCWRVNGTLAVSRAI 324

  Fly   466 GDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKK 530
            ||         ..::..:|...|.....:|..:::::|||||.::.:...|:...|...|...|.
  Rat   325 GD---------VFQKPYVSGEADAASRELTGLEDYLLLACDGFFDVVPHHEIPGLVHGHLLRQKG 380

  Fly   531 LST-ICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQELQ 572
            ... :.|||.      ....|....||:|.::|..:..|:.|:
  Rat   381 SGMHVAEELV------AVARDRGSHDNITVMVVFLRDPLELLE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 58/195 (30%)
Ppm1fNP_786931.1 PP2C 151..402 CDD:395385 77/325 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.