DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ppm1d

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001099295.2 Gene:Ppm1d / 287585 RGDID:1305460 Length:598 Species:Rattus norvegicus


Alignment Length:334 Identity:77/334 - (23%)
Similarity:130/334 - (38%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SGCTAVVCLLQGRDLYVANAGDSRCVISRSG-------QAIEMSIDHKPEDDEEASRIIKAGG-- 447
            ||.||.|.:::|..:|||:.|||..|:....       :|:|::.|||||..:|..||...||  
  Rat   164 SGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSV 228

  Fly   448 --------------RVTLDGRVNGG--------LNLSRALGDHAYKTNVTLPAEEQMISALPDIK 490
                          |:|..|.|...        |.::|||||   ..:....:.:.::|..||..
  Rat   229 MNKSGVNRVVWKRPRLTHSGPVRRSTVIDQIPFLAVARALGD---LWSYDFFSGKFVVSPEPDTS 290

  Fly   491 KLIITPE-DEFMVLACDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGD-GTG 553
            ...:.|: .::::|..||:||.:..::.:..  |:.::.||.               .||: |..
  Rat   291 VHTLDPQKHKYIILGSDGLWNMVPPQDAISM--CQDQEEKKY---------------LMGEQGQS 338

  Fly   554 C-------------------DNMTAVIVQFKKKLQELQSTIPPNQ----TEDKLLKTSENVSHSL 595
            |                   ||.:|:::....::.        ||    .||:|.....: |.:.
  Rat   339 CAKMLVNRALGRWRQRMLRADNTSAIVICISPEVD--------NQGNFTNEDELFLNLTD-SPTY 394

  Fly   596 NDQSASKRCASQNADADDEILEKNNSKRLKTDLEQENIKDRTPSPSNQN-------EDPTQKAIK 653
            |.|.......|.::....:.||::...||       |.||..|:....|       |.|.:.|..
  Rat   395 NSQETCVMTPSPSSTPPVKSLEEDPWPRL-------NSKDHIPALVRSNAFSEKFLEVPAEIARG 452

  Fly   654 EVTIIVSSS 662
            .:..:|.:|
  Rat   453 SIQTVVMTS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 54/223 (24%)
Ppm1dNP_001099295.2 PP2C 84..361 CDD:278884 52/216 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.