DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Ppm1n

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_006539883.1 Gene:Ppm1n / 232941 MGIID:2142330 Length:452 Species:Mus musculus


Alignment Length:213 Identity:80/213 - (37%)
Similarity:112/213 - (52%) Gaps:13/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 GKDSGCTAVVCLLQGRDLYVANAGDSRCVISRSGQAIEMSIDHKPEDDEEASRIIKAGGRVTLDG 453
            |...|.|||..|:..|.||:|:.||||.::||||.....:.||:|....|..||..|||.|. ..
Mouse   151 GDPGGSTAVALLVSPRFLYLAHCGDSRALLSRSGSVAFCTEDHRPHRPRERERIHDAGGTVR-RR 214

  Fly   454 RVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVV 518
            ||.|.|.:||||||.|||.....|.|.|::||.|::..|....||||::||.||:|:.:|..::.
Mouse   215 RVEGSLAVSRALGDFAYKQAPGRPPELQLVSAEPEVAALARQDEDEFVLLASDGVWDALSGADLA 279

  Fly   519 EFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQELQSTIPPNQTEDK 583
            ..|..||:....|..:|.:|.|.||...::      ||||.::|.|....:..:..|      .|
Mouse   280 GLVTSRLRLGLDLELLCAQLLDTCLCKGSL------DNMTCMVVCFPGAPRPCEEAI------SK 332

  Fly   584 LLKTSENVSHSLNDQSAS 601
            .:...|.:||.:.:..||
Mouse   333 EMALDEALSHKVAELYAS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 72/174 (41%)
Ppm1nXP_006539883.1 PP2Cc 59..319 CDD:238083 72/174 (41%)
PP2C_C 313..387 CDD:369544 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.