DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ilkp-1

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_496370.2 Gene:ilkp-1 / 185220 WormBaseID:WBGene00009354 Length:322 Species:Caenorhabditis elegans


Alignment Length:400 Identity:100/400 - (25%)
Similarity:150/400 - (37%) Gaps:119/400 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DPSAKPDGSSTSAAAAAAALSADGVANSRNPSNVVNPMAGADSNTTTSINDLSTKNAALKDDS-- 259
            |.|.||..|.......||.....|.......::::.|..           ||.|:.:.|...|  
 Worm    18 DESKKPKESRNLYCTLAAYGCRKGERADMQDTHIMLPKF-----------DLGTEKSFLSRASFF 71

  Fly   260 -VNDQNEGSNGTDFKHTLVSSSNKKLFATGSNDMTELNQSSKNEFTNSSTSKEFERNINSSQDDE 323
             :.|.:.|....:...:.:..:.|:..|..| |...|.:|.|..||.|          ..:.||.
 Worm    72 AIFDGHAGPRAAEHCQSQMGKTVKEKLAKFS-DFPTLTKSLKQTFTES----------YKAVDDG 125

  Fly   324 FTDDDADYEENDNVKSPDTSSAESSDCTENDDDGDEDGNEDSDEEETDEDQMANDNFCANMIEEP 388
            |.                                                .:|..|       :|
 Worm   126 FL------------------------------------------------AIAKQN-------KP 135

  Fly   389 GKDSGCTAVVCLLQGRDLYVANAGDSRCVISR-----SGQAIEMSIDHKPEDDEEASRIIKAGGR 448
            ....|.||...::....:||||.||||.|::|     |...:.:::||.|...:|..||.|||. 
 Worm   136 IWKDGTTATTMIILNNVIYVANIGDSRAVVARKKEDGSFAPVCLTVDHDPMSHDERMRIQKAGA- 199

  Fly   449 VTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPEDEFMVLACDGIWNYMS 513
            |..|||:||.:.:||::||        ||.:...|.:.||:|||.:|..|.|.::||||:|...|
 Worm   200 VVKDGRINGVIEVSRSIGD--------LPFKSLGIISTPDLKKLTLTKNDLFAIIACDGLWKSFS 256

  Fly   514 SEEVVEFVRCRLKDNKK---------------LSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQ 563
            :.|.|.|...:|:..||               |..:.|:     ||...:....| ||::.:|| 
 Worm   257 NLEAVSFAVEQLEAAKKTDIEQEPNESREAAELRVVAEK-----LAAEAVRRKCG-DNVSVIIV- 314

  Fly   564 FKKKLQELQS 573
               ||:.:.|
 Worm   315 ---KLELIDS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 68/209 (33%)
ilkp-1NP_496370.2 PP2Cc 34..316 CDD:238083 92/377 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.