DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and tap-1

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_510428.1 Gene:tap-1 / 181556 WormBaseID:WBGene00006524 Length:386 Species:Caenorhabditis elegans


Alignment Length:275 Identity:65/275 - (23%)
Similarity:120/275 - (43%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 EDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANAGDSRCVISRSGQAIEMSID-HKPED 435
            |:|....|...:.|.:..: .|.||:|.::..:||||.|.|:|..:...|...::::.: |..::
 Worm   123 EEQSETGNNAVSEINQKIR-QGTTAIVVMIINQDLYVLNCGNSLAIAMNSENVVQLNSNLHNNDN 186

  Fly   436 DEEASRIIKAGGRVTLDGRVNGG--LNLSRALGD----HAY-KTNVTLPAEEQMISALPDIKKLI 493
            ..|..||...|        :|..  ||.:||:||    |.: :|.....|:...:.:.||::...
 Worm   187 PLEIVRIKGLG--------INPETVLNPTRAIGDLQRTHLFEETEAFKNAKGPPVISTPDVQYTK 243

  Fly   494 ITPEDEFMVLACDGIWNYMSSEEVVEF---VRCRLKDNKKLSTICEELFDNCLAPN----TMGDG 551
            |.|....:||..||:...:...||...   |..||.::..:::..:.|.|:....:    ||.|.
 Worm   244 IDPSWRHLVLISDGVVQNLKEVEVENIPTEVSVRLIEDHTVTSTAQALVDSFARKHRDAYTMSDD 308

  Fly   552 TG-C-----DNMTAVIVQFKKKLQELQSTIPPNQTEDKLLKTSENVSHSLNDQSASKRCASQNAD 610
            .. |     :.||.:.|:.:   ::.|:.:  .:..|..:.|.|:.:.:|.:.     |::...|
 Worm   309 KNFCISNHREEMTVIYVKLE---EDYQAAL--YEQFDSAISTMESTNATLYEP-----CSTPYVD 363

  Fly   611 ADDEILEKNNSKRLK 625
            |.:....||..|..|
 Worm   364 ATNFNSGKNYEKMKK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 52/210 (25%)
tap-1NP_510428.1 PP2Cc 21..327 CDD:238083 53/212 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.