DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and fem-2

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:266 Identity:71/266 - (26%)
Similarity:117/266 - (43%) Gaps:63/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 DEEETDEDQ------MANDNFCANMIEEPGKDSGCTAVVCLLQGRDLYVANA--GDSRCVISRSG 422
            |..::.|||      :.::......::|..| .|.|||.|.:......:|.|  |||...:..:.
 Worm   229 DPSDSLEDQLRKSLELLDERMTVRSVKECWK-GGSTAVCCAIDMDQKLMALAWLGDSPGYVMSNI 292

  Fly   423 QAIEMSIDHKPEDDEEASRIIKAGGRVTLDG---RVNGGLNLSRALGDHAYKTNVTLPAEEQMIS 484
            :..:::..|.|.|:.||.|:.:|||::.:.|   ||||.|||:|||||        :|. ..|||
 Worm   293 EFRQLTRGHSPSDEREARRVEEAGGQLFVIGGELRVNGVLNLTRALGD--------VPG-RPMIS 348

  Fly   485 ALPDIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFVRC-----RLKDNKKLST-ICEELFDNCL 543
            ..|:..::.|...|..::||||||.:..:..::.:.|..     .::|..:||. ||.:..    
 Worm   349 NEPETCQVPIESSDYLVLLACDGISDVFNERDLYQLVEAFANDYPVEDYAELSRFICTKAI---- 409

  Fly   544 APNTMGDGTGCDNMTAVIVQFKKKLQELQSTIPPNQTEDKLLKTSENVSHSLNDQSASKRCASQN 608
                  :....||::.||           ..:.|.|...||:|      |..:|         ::
 Worm   410 ------EAGSADNVSVVI-----------GFLRPPQDVWKLMK------HESDD---------ED 442

  Fly   609 ADADDE 614
            :|..||
 Worm   443 SDVTDE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 58/206 (28%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 58/207 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.