DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and Pp2d1

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_775625.1 Gene:Pp2d1 / 110332 MGIID:3612067 Length:620 Species:Mus musculus


Alignment Length:295 Identity:60/295 - (20%)
Similarity:120/295 - (40%) Gaps:86/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 SGCTAVVCLLQG--------RD------------------------LYVANAGDSRCVISRSGQA 424
            |||:|:.|:|:|        :|                        |::||||:.:.|:.|:|:.
Mouse   314 SGCSALTCILEGGIKNPHANKDWEKTYQQGSTSLPFQKTPQIISGVLHLANAGNVQAVLCRNGKG 378

  Fly   425 IEMSIDHKPEDDEEASRIIKAGGRVTLD---GRVNGGLNLSRALGDHAYKTNVTLPAEEQMISAL 486
            ..::.:|...:.:|..|::.:...::.|   |.::|.:..:|.||.|.   |:.|..     |.:
Mouse   379 FCLTKEHSTRNTKERRRVLYSEAVISSDDPYGLLDGHIKTTRGLGFHG---NLRLKK-----SII 435

  Fly   487 PDIKKLIITPED--EFMVLACDGIWNYMSSEEVVEFV-------------RCRLKDNKKLSTICE 536
            |..:.:.:..:|  :|::||.:|:|..:..:||...|             |.:.|....:     
Mouse   436 PAPQTISVPIDDLCQFLILATNGLWQVLDKKEVTALVITLFHAYKETHVPRPKSKPWPPI----- 495

  Fly   537 ELFDNCLAPNTMGDGTGCDNMTAVIVQFKKKLQELQSTIPPNQTEDKLLKTSENVSHSLNDQSAS 601
                ..|:|.        |:...|:.|::.:.:::.||          ...::.:|.|:..::.:
Mouse   496 ----GLLSPP--------DSNIRVLFQYQPENEDIMST----------ADGTKGLSDSIYAEAYT 538

  Fly   602 KR-CASQNADADDEILEKNNSKRLKTDLEQENIKD 635
            .: ..|......|....|.||.....|.:|||.|:
Mouse   539 HQGTFSPKVTPYDPCSTKENSSLPTIDSKQENEKE 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 45/221 (20%)
Pp2d1NP_775625.1 PP2Cc 187..472 CDD:238083 38/165 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.