DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10417 and ilkap

DIOPT Version :9

Sequence 1:NP_610169.1 Gene:CG10417 / 35492 FlyBaseID:FBgn0033021 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001082973.2 Gene:ilkap / 100037350 ZFINID:ZDB-GENE-070410-122 Length:345 Species:Danio rerio


Alignment Length:220 Identity:73/220 - (33%)
Similarity:110/220 - (50%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 ETDEDQMANDNFCANMIEEPGKDSGCTAVVCLLQGRD-LYVANAGDSRCVISRSGQA-------- 424
            :||||.:...:     .::|....|.|| .|||...| |||||.||||.|:.|..||        
Zfish   145 QTDEDFLKKAS-----SQKPAWKDGSTA-TCLLAVDDVLYVANLGDSRAVLCRMEQAKDSGKRKC 203

  Fly   425 --IEMSIDHKPEDDEEASRIIKAGGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALP 487
              :.:|.:|.|...||..||.:|||.|. ||||.|.|.:||::||..||        ...:.:.|
Zfish   204 VTLALSKEHNPTIYEERMRIQRAGGTVR-DGRVLGVLEVSRSIGDGQYK--------RCGVISTP 259

  Fly   488 DIKKLIITPEDEFMVLACDGIWNYMSSEEVVEFV-------RCRLKDNKK-----LSTICEELFD 540
            |:::..::|.|:|::|||||::...|::|.|:||       ...||:.:.     ....|:.   
Zfish   260 DLRRCQLSPNDKFVLLACDGLFKVFSADEAVQFVLGVLENETVELKEGQSEGAGLFEAACQR--- 321

  Fly   541 NCLAPNTMGDGTGCDNMTAVIVQFK 565
              ||...:..|: .||:|.::|..:
Zfish   322 --LASEAVRRGS-ADNVTVILVSIE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10417NP_610169.1 PP2Cc 18..>100 CDD:214625
PP2Cc <374..564 CDD:238083 69/212 (33%)
ilkapNP_001082973.2 PP2Cc 59..342 CDD:238083 73/217 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.