DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and APOBEC3B

DIOPT Version :10

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_004891.5 Gene:APOBEC3B / 9582 HGNCID:17352 Length:382 Species:Homo sapiens


Alignment Length:79 Identity:21/79 - (26%)
Similarity:27/79 - (34%) Gaps:28/79 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 WKKLSLDEKKQLYR-YSFCQTYAEFQHITPEWKMCLGVALWLVSIGIAISITMKTVL-YGKLPD- 139
            |:....:|.:|... |.|.:.|| |.|                       .|:|.:| |...|| 
Human   157 WENFVYNEGQQFMPWYKFDENYA-FLH-----------------------RTLKEILRYLMDPDT 197

  Fly   140 -TFNDERQSAQLRR 152
             |||.......|||
Human   198 FTFNFNNDPLVLRR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 Cyt_c_Oxidase_IV 35..170 CDD:238462 21/79 (27%)
APOBEC3BNP_004891.5 NAD2 10..189 CDD:436733 11/55 (20%)
NAD2 191..377 CDD:436733 9/21 (43%)

Return to query results.
Submit another query.