DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and COX5B

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_012155.1 Gene:COX5B / 854695 SGDID:S000001373 Length:151 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:25/120 - (20%)
Similarity:44/120 - (36%) Gaps:26/120 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PAIRYREVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEF------------QHITPEW 108
            |.:..:|::..   |.|::...||.|:.:|.|..:..|    |.|:            ..||...
Yeast    39 PNLEQKEIADN---LTERQKLPWKTLNNEEIKAAWYIS----YGEWGPRRPVHGKGDVAFITKGV 96

  Fly   109 KMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITG 163
            .:.||::..|..:       ::.:...:.|.|.|.|.|......:.....||..|
Yeast    97 FLGLGISFGLFGL-------VRLLANPETPKTMNREWQLKSDEYLKSKNANPWGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 25/120 (21%)
COX5BNP_012155.1 Cyt_c_Oxidase_IV 18..151 CDD:238462 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.