DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and Cox4i2

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017447568.1 Gene:Cox4i2 / 84683 RGDID:69422 Length:233 Species:Rattus norvegicus


Alignment Length:129 Identity:44/129 - (34%)
Similarity:71/129 - (55%) Gaps:4/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FDSPDCPFPAIRYREVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEFQHITPEWKMCL 112
            :..||.|:    ..|:|.|..||:|||...|.:||..||..|||..|.:|:||..|.:.|||..:
  Rat   108 YPMPDEPY----CTELSEEQRALKEKEKGSWAQLSQAEKVALYRLQFHETFAEMNHRSNEWKTVM 168

  Fly   113 GVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITGLASKWCYRENKWK 176
            |...:.:.....:....:..::.|...|..:||::.||:|::.::.|||.||::.|.|.:.:||
  Rat   169 GCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLSAHWDYEKKEWK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 42/127 (33%)
Cox4i2XP_017447568.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344991
Domainoid 1 1.000 108 1.000 Domainoid score I6289
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4813
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm9068
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.