DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment COX4L and AICDA

DIOPT Version :9

Sequence 1:	NP_610168.1	Gene:	COX4L / 35491	FlyBaseID:	FBgn0033020	Length:	176	Species:	Drosophila melanogaster
Sequence 2:	NP_065712.1	Gene:	AICDA / 57379	HGNCID:	13203	Length:	198	Species:	Homo sapiens

Alignment Length:	132	Identity:	32/132 - (24%)
Similarity:	42/132 - (31%)	Gaps:	52/132 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 ELCALREKELDDWKKLSLDEKKQLYR----------YSFCQTYAEFQHITPEWKMCLGVA----- 115
            ||..||  .:.||   .||..: .||          |...:..|:|....|...:.:..|
Human    58 ELLFLR--YISDW---DLDPGR-CYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFC 116

  Fly   116 ------------LWLVSIGIAISITMKTVLYGKLPDTF----------------NDERQSAQLRR 152
                        |....:.||| :|.|...|  ..:||                |..|.|.||||
Human   117 EDRKAEPEGLRRLHRAGVQIAI-MTFKDYFY--CWNTFVENHERTFKAWEGLHENSVRLSRQLRR 178

  Fly   153 II 154
            |:
Human   179 IL 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
COX4L	NP_610168.1	COX4	45..176	CDD:281003	32/132 (24%)
AICDA	NP_065712.1	Bipartite nuclear localization signal. /evidence=ECO:0000269\|PubMed:14769937	1..30
		Interaction with SUPT6H. /evidence=ECO:0000269\|PubMed:21518874	2..26
		APOBEC2	6..180	CDD:376193	31/130 (24%)
		Important for interaction with CTNNBL1. /evidence=ECO:0000269\|PubMed:18722174	39..42
		Required for interaction with RNF126. /evidence=ECO:0000269\|PubMed:23277564	88..116		5/27 (19%)
		Nuclear export signal. /evidence=ECO:0000269\|PubMed:14769937	183..198
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4075
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900