DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and cox4i1l

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001373397.1 Gene:cox4i1l / 402880 ZFINID:ZDB-GENE-130814-2 Length:173 Species:Danio rerio


Alignment Length:134 Identity:45/134 - (33%)
Similarity:73/134 - (54%) Gaps:3/134 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PIYFDSPDCPFPAIRY-REVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEFQHITPEW 108
            |.|.:..|.|.|.:.: |.:|.|...|:|||...|.:||.:||..:||.:...::.|.:..:.||
Zfish    41 PQYNNRLDTPLPDVPFVRNLSAEQKKLKEKEKGPWTQLSKEEKLAIYRLTHELSFPEMRKGSKEW 105

  Fly   109 KMCL-GVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITGLASKWCYRE 172
            ...| ||..:|...|:.: ...:..:||.:|.|.:.|....|.:|::.:::|||||.|.||.|.:
Zfish   106 MTVLAGVFFFLGFTGLLV-WWQRVFVYGDVPHTLSQEWIEKQTQRMLDMKVNPITGFAHKWDYEK 169

  Fly   173 NKWK 176
            .:||
Zfish   170 KQWK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 43/132 (33%)
cox4i1lNP_001373397.1 COX4 41..173 CDD:397197 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585959
Domainoid 1 1.000 113 1.000 Domainoid score I6082
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4826
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm6589
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.