DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and COX4

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster


Alignment Length:146 Identity:75/146 - (51%)
Similarity:98/146 - (67%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VADRQVVGHGINGRPIYFDSPDCPFPAIRYREVSPELCALREKELDDWKKLSLDEKKQLYRYSFC 95
            :..|::||:|.||...|.|..|.|.||:|:||.:.|:.|||.||..||||||..|.|.|||.|||
  Fly    36 IGKREIVGYGWNGTACYADRVDYPLPAVRFREPTNEINALRAKEQGDWKKLSTQEIKALYRASFC 100

  Fly    96 QTYAEFQHITPEWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNP 160
            ||.||.|..:.|||:.|||:|...:..|.:::.|...:|.:||.||::|.|.|||:|||.|::||
  Fly   101 QTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINP 165

  Fly   161 ITGLASKWCYRENKWK 176
            :|||.|||.|...|||
  Fly   166 VTGLTSKWDYENKKWK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 67/130 (52%)
COX4NP_001260612.1 COX4 50..181 CDD:281003 67/130 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455728
Domainoid 1 1.000 113 1.000 Domainoid score I6082
eggNOG 1 0.900 - - E1_KOG4075
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4826
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm6589
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - P PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
1312.840

Return to query results.
Submit another query.