DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and cox4i1

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_999866.1 Gene:cox4i1 / 326975 ZFINID:ZDB-GENE-030131-5175 Length:169 Species:Danio rerio


Alignment Length:144 Identity:47/144 - (32%)
Similarity:83/144 - (57%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HGI-----NGRPIYFDSPDCPFPAIRY-REVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQT 97
            ||:     ...|.|||..:.|.|.|:: :::|.:..:|:|||...|..||.:||..|||.||.::
Zfish    25 HGVAKVEDYSLPAYFDRRESPLPEIKFVQQLSADQKSLKEKEKGSWAALSKEEKIALYRISFKES 89

  Fly    98 YAEFQHITPEWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPIT 162
            :||....:.|||..:....:.|.:...:.:..:..:||.:|:||:.|.:..:::|::.:::||:.
Zfish    90 FAEMNQGSGEWKSVVAGIFFFVGLTGLVVLWQRKYVYGDVPNTFDPEYKQKEIQRMLDMRINPVQ 154

  Fly   163 GLASKWCYRENKWK 176
            |.|:||.|..|.||
Zfish   155 GFAAKWDYENNAWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 43/131 (33%)
cox4i1NP_999866.1 COX4 36..168 CDD:281003 43/131 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585957
Domainoid 1 1.000 113 1.000 Domainoid score I6082
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37537
Inparanoid 1 1.050 113 1.000 Inparanoid score I4826
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm6589
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.