DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and Apobec3

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001028875.1 Gene:Apobec3 / 315137 RGDID:1307800 Length:385 Species:Rattus norvegicus


Alignment Length:148 Identity:38/148 - (25%)
Similarity:51/148 - (34%) Gaps:45/148 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LRKLFQMT------RRRFASG-----------GDGIRLMVADRQVV----GH---------GING 43
            |:||:|.|      ..|:|.|           |....|.|..||.|    ||         ..:.
  Rat    21 LKKLYQQTFYFHFKNVRYAWGRKNNFLCYEVNGMDCALPVPLRQGVFRKQGHIHAELCFIYWFHD 85

  Fly    44 RPIYFDSPDCPFPAIRYREVSP-ELCALR-EKELDDWKKLSLD-EKKQLYRY--------SFCQT 97
            :.:...||...|....|...|| ..||.: .:.|...:.|||. ...:||.|        ..|:.
  Rat    86 KVLRVLSPMEEFKVTWYMSWSPCSKCAEQVARFLAAHRNLSLAIFSSRLYYYLRNPNYQQKLCRL 150

  Fly    98 YAEFQHIT----PEWKMC 111
            ..|..|:.    ||:|.|
  Rat   151 IQEGVHVAAMDLPEFKKC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 22/82 (27%)
Apobec3NP_001028875.1 APOBEC_N 29..199 CDD:285428 33/140 (24%)
cytidine_deaminase <71..150 CDD:238610 18/78 (23%)
APOBEC_C 141..186 CDD:283020 7/28 (25%)
APOBEC_N 212..378 CDD:285428
cytidine_deaminase 226..332 CDD:238610
APOBEC_C 322..365 CDD:283020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.