DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and APOBEC3C

DIOPT Version :10

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_055323.2 Gene:APOBEC3C / 27350 HGNCID:17353 Length:190 Species:Homo sapiens


Alignment Length:36 Identity:11/36 - (30%)
Similarity:17/36 - (47%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIYFDSPDCPFPAIRYREVSPELCALREKELDDWK 79
            |..||..| |....:  |.:|.|..|:...:.:|:|
Human   122 RLYYFQYP-CYQEGL--RSLSQEGVAVEIMDYEDFK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 Cyt_c_Oxidase_IV 35..170 CDD:238462 11/36 (31%)
APOBEC3CNP_055323.2 APOBEC2 12..190 CDD:465863 11/36 (31%)
(Microbial infection) Required for interaction with human foamy virus protein Bet. /evidence=ECO:0000269|PubMed:19074429 40..86
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.