DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and cox-4

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_493394.1 Gene:cox-4 / 173237 WormBaseID:WBGene00012354 Length:175 Species:Caenorhabditis elegans


Alignment Length:178 Identity:64/178 - (35%)
Similarity:95/178 - (53%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFPCMKLRKLFQMTR----RRFASGGDGIRLMVADRQVVGHGINGRPIYFDSPDCPFPAIRYREV 63
            :.|.:.||.:....|    :.|..|.|    ..|.|::||:|.||..||.|..|..:||||:|:.
 Worm     2 MLPRLALRAVHTTARLSGGQEFYWGPD----KAAGRELVGYGANGDNIYQDRLDYWYPAIRFRKE 62

  Fly    64 SPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEFQHITPEWKMCLGVALWLVSIGIAISIT 128
            ...:..:|.||..|||.||.:|||.||||||.||.:||:..|..||:...|.|.::.:....::.
 Worm    63 DSVIAPIRAKEQADWKNLSAEEKKLLYRYSFRQTLSEFEAPTGYWKVISAVILSVLGLCTYYAVL 127

  Fly   129 MKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITGLASKWCYRENKWK 176
            :...:|.:||.||.:|.:.||:.|.:.|:.....|..:.:.|...|||
 Worm   128 LNVCVYPELPPTFQNEYKEAQVERALVLEKGQFLGAPTHYDYENKKWK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 48/130 (37%)
cox-4NP_493394.1 COX4 45..175 CDD:281003 48/129 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162094
Domainoid 1 1.000 134 1.000 Domainoid score I3102
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5258
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - otm14239
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.