DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and APOBEC3D

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_016884085.1 Gene:APOBEC3D / 140564 HGNCID:17354 Length:455 Species:Homo sapiens


Alignment Length:94 Identity:18/94 - (19%)
Similarity:37/94 - (39%) Gaps:26/94 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KKLSLDEKKQLYRYSFCQTYAEFQHITPEWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFND 143
            |::..:..:.:|.:.|   |..|:::.   |.|.....||       ..||:..           
Human   267 KEILRNPMEAMYPHIF---YFHFKNLL---KACGRNESWL-------CFTMEVT----------- 307

  Fly   144 ERQSAQLRR--IIQLQMNPITGLASKWCY 170
            :..||..|:  :.:.|::|.|...::.|:
Human   308 KHHSAVFRKRGVFRNQVDPETHCHAERCF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 18/94 (19%)
APOBEC3DXP_016884085.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.