DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and Cox4i1

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_034071.2 Gene:Cox4i1 / 12857 MGIID:88473 Length:206 Species:Mus musculus


Alignment Length:196 Identity:66/196 - (33%)
Similarity:101/196 - (51%) Gaps:27/196 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLRKLFQMTRR-RFASGGDGIRL-----MVADR--QVVG------------HGINGR------PI 46
            :||..|..:|. :...||.|.||     |:|.|  .::|            ||...:      |.
Mouse    10 RLRAPFFRSRAPQGVEGGRGGRLGSGGRMLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPT 74

  Fly    47 YFDSPDCPFPAIRY-REVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEFQHITPEWKM 110
            |.|..|.|.|.:.: ..:|....||:|||..||..||.|||.||||..|.:::||....|.|||.
Mouse    75 YADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKT 139

  Fly   111 CLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITGLASKWCYRENKW 175
            .:|:|::.:.....:.|..|:.:||.:|.||:.:..:.|.:|::.::.|||.|.::||.|.:|:|
Mouse   140 VVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEW 204

  Fly   176 K 176
            |
Mouse   205 K 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 49/131 (37%)
Cox4i1NP_034071.2 COX4 73..205 CDD:281003 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841629
Domainoid 1 1.000 106 1.000 Domainoid score I6576
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37537
Inparanoid 1 1.050 106 1.000 Inparanoid score I4913
Isobase 1 0.950 - 0 Normalized mean entropy S5258
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm8824
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.890

Return to query results.
Submit another query.