DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4L and LOC100127750

DIOPT Version :9

Sequence 1:NP_610168.1 Gene:COX4L / 35491 FlyBaseID:FBgn0033020 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017950442.1 Gene:LOC100127750 / 100127750 -ID:- Length:180 Species:Xenopus tropicalis


Alignment Length:135 Identity:45/135 - (33%)
Similarity:79/135 - (58%) Gaps:2/135 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPIYFDSPDCPFPAIRY-REVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAEFQH-ITP 106
            :|:|.:..:.|.|.:.: .|::|:..||:.||...|.:|:.:||..|||.||.|:|||... ...
 Frog    46 KPMYCERREYPLPDVPFVSELNPQQKALKLKENGPWGQLTKEEKLALYRISFNQSYAEMHSGSKS 110

  Fly   107 EWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQLRRIIQLQMNPITGLASKWCYR 171
            |||..:|..|:.::.|.......:..:||.:|.|.:::..:.|.:|:|.:::||:||.:|.|.|.
 Frog   111 EWKTIVGAVLYFLAFGGLYLWWHRIYVYGPVPHTLSEDWVAMQAKRMIDMRINPVTGFSSHWDYE 175

  Fly   172 ENKWK 176
            :.:||
 Frog   176 KKQWK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4LNP_610168.1 COX4 45..176 CDD:281003 43/132 (33%)
LOC100127750XP_017950442.1 COX4 47..180 CDD:367258 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6266
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4745
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm9486
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.