DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and FIP2

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_200311.1 Gene:FIP2 / 835591 AraportID:AT5G55000 Length:298 Species:Arabidopsis thaliana


Alignment Length:176 Identity:60/176 - (34%)
Similarity:94/176 - (53%) Gaps:24/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SQYLKLNVGGHLYYTTIGTLT-KNNDTMLSAMFSGRMEVLTDS-EGWILIDRCGNHFGIILNYLR 80
            |..::||:||..:.|||.||| :..|:||:||||||..:..:| :|::.|||.|.||..|||:||
plant     8 SSMVRLNIGGKKFCTTIDTLTIREPDSMLAAMFSGRHAMCQESKKGYVFIDRDGKHFRHILNWLR 72

  Fly    81 DGTVPLPETNKEIAELLAEAKYYCITEL--AISCERALYAHQEPKPICRIPLITSQKEEQL---- 139
            ||.:| ..::.:.:|||.||.||.:..|  .|...|......|.: :.||.:|...:.|::    
plant    73 DGVIP-SLSDPDCSELLREADYYQLLGLKDGIKDSRKEVGEVEAE-LTRIDIIKCIQTERVRFRG 135

  Fly   140 --LLSVSLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLR 183
              |..:.|....:.:|.     :||.      .|:|: .|.:.:|:
plant   136 VNLSGIDLSKLDLSLVD-----FSYA------CLRNV-FFSRTNLQ 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 45/100 (45%)
BTB_2 21..112 CDD:280393 44/94 (47%)
FIP2NP_200311.1 BTB_POZ_FIP2-like 11..99 CDD:349685 42/88 (48%)
YjbI 125..297 CDD:224276 10/57 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.