DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and AT3G09030

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_187515.1 Gene:AT3G09030 / 820055 AraportID:AT3G09030 Length:460 Species:Arabidopsis thaliana


Alignment Length:94 Identity:33/94 - (35%)
Similarity:51/94 - (54%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKLNVGGHLYYTTIGTLTKN-NDTMLSAMFSGRMEVLTDSEGW--ILIDRCGNHFGIILNYLRDG 82
            :||||||.::.|...|:..: .|::|:|:.:      :.|.|.  :.|||....|.:|||.||.|
plant    10 VKLNVGGEIFETNASTIQSSCPDSLLAALST------STSHGSNPVFIDRDPEIFAVILNLLRTG 68

  Fly    83 TVPLPET---NKEIAELLAEAKYYCITEL 108
            .:|...:   :|:  |||.||.||.:..|
plant    69 RLPANSSGVFSKQ--ELLDEAMYYGVESL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 33/94 (35%)
AT3G09030NP_187515.1 BTB_POZ_KCTD-like 10..90 CDD:349625 30/87 (34%)

Return to query results.
Submit another query.