DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and AT3G09030

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_187515.1 Gene:AT3G09030 / 820055 AraportID:AT3G09030 Length:460 Species:Arabidopsis thaliana


Alignment Length:94 Identity:33/94 - (35%)
Similarity:51/94 - (54%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKLNVGGHLYYTTIGTLTKN-NDTMLSAMFSGRMEVLTDSEGW--ILIDRCGNHFGIILNYLRDG 82
            :||||||.::.|...|:..: .|::|:|:.:      :.|.|.  :.|||....|.:|||.||.|
plant    10 VKLNVGGEIFETNASTIQSSCPDSLLAALST------STSHGSNPVFIDRDPEIFAVILNLLRTG 68

  Fly    83 TVPLPET---NKEIAELLAEAKYYCITEL 108
            .:|...:   :|:  |||.||.||.:..|
plant    69 RLPANSSGVFSKQ--ELLDEAMYYGVESL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 33/94 (35%)
BTB_2 21..112 CDD:280393 33/94 (35%)
AT3G09030NP_187515.1 BTB_POZ_KCTD-like 10..90 CDD:349625 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11145
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.