DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and TNFAIP1

DIOPT Version :9

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_016880482.1 Gene:TNFAIP1 / 7126 HGNCID:11894 Length:391 Species:Homo sapiens


Alignment Length:218 Identity:148/218 - (67%)
Similarity:174/218 - (79%) Gaps:3/218 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHSSQYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGRMEVLTDSEGWILIDRCGNHFGIILNYL 79
            |..::|::|||||.|||||:..||: :||||.||||||||||||.||||||||||.|||.|||||
Human    24 GLGNKYVQLNVGGSLYYTTVRALTR-HDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGTILNYL 87

  Fly    80 RDGTVPLPETNKEIAELLAEAKYYCITELAISCERALYAHQEP-KPICRIPLITSQKEEQLLLSV 143
            ||.|:.||:..:||.||:||||||.|..|...|:.||...::. :|:|.||:|||.|||:.|:..
Human    88 RDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIES 152

  Fly   144 SLKPAVILVVQRQNNKYSYTSTSDDNLLKNIELFDKLSLRFNERILFIKDVIGPSEICCWSFYGH 208
            |.||.|.|:..|.||||||||.|||:||||||||||||||||.|:|||||||| .|||||||||.
Human   153 STKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIG-DEICCWSFYGQ 216

  Fly   209 GKKVAEVCCTSIVYATDRKHTKV 231
            |:|:||||||||||||::|.|||
Human   217 GRKLAEVCCTSIVYATEKKQTKV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB 20..117 CDD:197585 66/96 (69%)
BTB_2 21..112 CDD:280393 63/90 (70%)
TNFAIP1XP_016880482.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142091
Domainoid 1 1.000 221 1.000 Domainoid score I2618
eggNOG 1 0.900 - - E1_KOG2716
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 366 1.000 Inparanoid score I2164
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48414
OrthoDB 1 1.010 - - D1306250at2759
OrthoFinder 1 1.000 - - FOG0001839
OrthoInspector 1 1.000 - - otm42284
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.