DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10465 and Kctd12b

DIOPT Version :10

Sequence 1:NP_610165.1 Gene:CG10465 / 35488 FlyBaseID:FBgn0033017 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_003752068.1 Gene:Kctd12b / 681355 RGDID:1596735 Length:292 Species:Rattus norvegicus


Alignment Length:93 Identity:35/93 - (37%)
Similarity:52/93 - (55%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QYLKLNVGGHLYYTTIGTLTKNNDTMLSAMFSGR--MEVLTDSEGWILIDRCGNHFGIILNYLRD 81
            :.::|||||.:|.|...||.....:.|..|||.:  ..::.|::|...|||.|..|..:|:|:||
  Rat    21 EIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDNKGRFFIDRDGFLFRYVLDYMRD 85

  Fly    82 GTVPLPETNKEIAELLAEAKYYCITELA 109
            ..|.||:...|...|..||:|:.:.|||
  Rat    86 MQVVLPDHFPECGRLHREAEYFKLPELA 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10465NP_610165.1 BTB_POZ_KCTD10-like_BACURD 21..112 CDD:349678 35/91 (38%)
Kctd12bXP_003752068.1 BTB_POZ_KCTD8-like 19..118 CDD:349676 35/93 (38%)
H1_KCTD12b 174..291 CDD:409027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.